Lineage for d1z2cb1 (1z2c B:83-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006858Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 protein domains)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
  6. 2006859Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 2006860Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 2006867Domain d1z2cb1: 1z2c B:83-443 [124377]
    Other proteins in same PDB: d1z2ca1, d1z2cc_
    complexed with gnp, mg

Details for d1z2cb1

PDB Entry: 1z2c (more details), 3 Å

PDB Description: Crystal structure of mDIA1 GBD-FH3 in complex with RhoC-GMPPNP
PDB Compounds: (B:) Diaphanous protein homolog 1

SCOPe Domain Sequences for d1z2cb1:

Sequence, based on SEQRES records: (download)

>d1z2cb1 a.118.1.23 (B:83-443) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtskagmnqkessrsammyiqe
lrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdekeetsgnyds
rnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmidaakllsalcilpq
pedmnervleamteraemdeverfqplldglksgtsialkvgclqlinalitpaeeldfr
vhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfg
evfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvsqivlhkngtdpd
f

Sequence, based on observed residues (ATOM records): (download)

>d1z2cb1 a.118.1.23 (B:83-443) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
vlvlfeqmlvdmnlneekqqplrekdivikremvsqylhtsssrsammyiqelrsglrdm
hllscleslrvslnnnpvswvqtfgaeglaslldilkrlhdekdsrnqheiirclkafmn
nkfgiktmleteegilllvramdpavpnmmidaakllsalcilpqpedmnervleamter
aemdeverfqplldglksgtsialkvgclqlinalitpaeeldfrvhirselmrlglhqv
lqelreienedmkvqlcvfdeqgdedffdlkgrlddirmemddfgevfqiilntvkdska
ephflsilqhlllvrndyearpqyyklieecvsqivlhkngtdpdf

SCOPe Domain Coordinates for d1z2cb1:

Click to download the PDB-style file with coordinates for d1z2cb1.
(The format of our PDB-style files is described here.)

Timeline for d1z2cb1: