Lineage for d1z2ca1 (1z2c A:1-179)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988440Protein RhoC [142245] (1 species)
  7. 988441Species Human (Homo sapiens) [TaxId:9606] [142246] (1 PDB entry)
    Uniprot P08134 1-179
  8. 988442Domain d1z2ca1: 1z2c A:1-179 [124376]
    Other proteins in same PDB: d1z2cb1, d1z2cd1
    complexed with gnp, mg

Details for d1z2ca1

PDB Entry: 1z2c (more details), 3 Å

PDB Description: crystal structure of mdia1 gbd-fh3 in complex with rhoc-gmppnp
PDB Compounds: (A:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d1z2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2ca1 c.37.1.8 (A:1-179) RhoC {Human (Homo sapiens) [TaxId: 9606]}
maairkklvivgdgacgktcllivnskdqfpevyvptvfenyiadievdgkqvelalwdt
agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
lrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematragl

SCOPe Domain Coordinates for d1z2ca1:

Click to download the PDB-style file with coordinates for d1z2ca1.
(The format of our PDB-style files is described here.)

Timeline for d1z2ca1: