Lineage for d1z2be1 (1z2b E:4-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778481Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
  5. 778482Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 778483Protein Stathmin 4 [101496] (1 species)
  7. 778484Species Rat (Rattus norvegicus) [TaxId:10116] [101497] (5 PDB entries)
  8. 778486Domain d1z2be1: 1z2b E:4-141 [124375]
    Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb1, d1z2bb2, d1z2bc1, d1z2bc2, d1z2bd1, d1z2bd2
    automatically matched to d1sa0e_
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2be1

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (E:) rb3 stathmin-like domain 4

SCOP Domain Sequences for d1z2be1:

Sequence, based on SEQRES records: (download)

>d1z2be1 a.137.10.1 (E:4-141) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d1z2be1 a.137.10.1 (E:4-141) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
elke

SCOP Domain Coordinates for d1z2be1:

Click to download the PDB-style file with coordinates for d1z2be1.
(The format of our PDB-style files is described here.)

Timeline for d1z2be1: