Lineage for d1z2be1 (1z2b E:5-141)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (43 PDB entries)
  8. 2012555Domain d1z2be1: 1z2b E:5-141 [124375]
    Other proteins in same PDB: d1z2ba1, d1z2ba2, d1z2bb1, d1z2bb2, d1z2bc1, d1z2bc2, d1z2bd1, d1z2bd2, d1z2be2
    automatically matched to d1sa0e_
    complexed with cn2, gdp, gtp, mg, vlb

Details for d1z2be1

PDB Entry: 1z2b (more details), 4.1 Å

PDB Description: Tubulin-colchicine-vinblastine: stathmin-like domain complex
PDB Compounds: (E:) rb3 stathmin-like domain 4

SCOPe Domain Sequences for d1z2be1:

Sequence, based on SEQRES records: (download)

>d1z2be1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d1z2be1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekreh
ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke
lke

SCOPe Domain Coordinates for d1z2be1:

Click to download the PDB-style file with coordinates for d1z2be1.
(The format of our PDB-style files is described here.)

Timeline for d1z2be1: