Lineage for d1z26a1 (1z26 A:2-323)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 666081Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 666082Family b.34.14.1: PAZ domain [101691] (5 proteins)
  6. 666102Protein Argonaute homologue PF0537 [110167] (1 species)
    includes the N-terminal domain
  7. 666103Species Pyrococcus furiosus [TaxId:2261] [110168] (3 PDB entries)
  8. 666105Domain d1z26a1: 1z26 A:2-323 [124372]
    Other proteins in same PDB: d1z26a2
    automatically matched to d1u04a1
    complexed with wo4; mutant

Details for d1z26a1

PDB Entry: 1z26 (more details), 2.5 Å

PDB Description: structure of pyrococcus furiosus argonaute with bound tungstate
PDB Compounds: (A:) Argonaute

SCOP Domain Sequences for d1z26a1:

Sequence, based on SEQRES records: (download)

>d1z26a1 b.34.14.1 (A:2-323) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
kaivvinlvkinkkiipdkiyvyrlfndpeeelqkegysiyrlayenvgividpenliia
ttkeleyegefipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgd
ykvipsvemsvikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkd
iasplktvykpcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlk
qpailakfaskikknknykiyllpqlvvptynaeqlesdvakeileytklmpeerkelle
nilaevdsdiidkslseievek

Sequence, based on observed residues (ATOM records): (download)

>d1z26a1 b.34.14.1 (A:2-323) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
kaivvinlvkinkkiipdkiyvyrlysiyrlayenvgividpenliiattkeleyegefi
pegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgdykvipsvemsvi
khdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkdiasplktvykpc
feeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlkqpailakfaskn
ykiyllpqlvvptynaeqlakeileytklmpeerkellenilaevdsdiidkslseieve
k

SCOP Domain Coordinates for d1z26a1:

Click to download the PDB-style file with coordinates for d1z26a1.
(The format of our PDB-style files is described here.)

Timeline for d1z26a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z26a2