Lineage for d1z26a1 (1z26 A:1-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047718Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2047719Family b.34.14.1: PAZ domain [101691] (6 protein domains)
  6. 2047740Protein Argonaute homologue PF0537 [110167] (1 species)
    includes the N-terminal domain
  7. 2047741Species Pyrococcus furiosus [TaxId:2261] [110168] (3 PDB entries)
    Uniprot Q8U3D2
  8. 2047743Domain d1z26a1: 1z26 A:1-323 [124372]
    Other proteins in same PDB: d1z26a3, d1z26a4, d1z26a5
    automated match to d1u04a1
    complexed with wo4

Details for d1z26a1

PDB Entry: 1z26 (more details), 2.5 Å

PDB Description: Structure of Pyrococcus furiosus Argonaute with bound tungstate
PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d1z26a1:

Sequence, based on SEQRES records: (download)

>d1z26a1 b.34.14.1 (A:1-323) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
mkaivvinlvkinkkiipdkiyvyrlfndpeeelqkegysiyrlayenvgividpenlii
attkeleyegefipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfg
dykvipsvemsvikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlk
diasplktvykpcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdl
kqpailakfaskikknknykiyllpqlvvptynaeqlesdvakeileytklmpeerkell
enilaevdsdiidkslseievek

Sequence, based on observed residues (ATOM records): (download)

>d1z26a1 b.34.14.1 (A:1-323) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
mkaivvinlvkinkkiipdkiyvyrlysiyrlayenvgividpenliiattkeleyegef
ipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgdykvipsvemsv
ikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkdiasplktvykp
cfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlkqpailakfask
nykiyllpqlvvptynaeqlakeileytklmpeerkellenilaevdsdiidkslseiev
ek

SCOPe Domain Coordinates for d1z26a1:

Click to download the PDB-style file with coordinates for d1z26a1.
(The format of our PDB-style files is described here.)

Timeline for d1z26a1: