Lineage for d1z25a2 (1z25 A:324-770)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 996500Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 996509Protein Argonaute homologue PF0537 [110641] (1 species)
    includes the middle domain
  7. 996510Species Pyrococcus furiosus [TaxId:2261] [110642] (3 PDB entries)
    Uniprot Q8U3D2
  8. 996513Domain d1z25a2: 1z25 A:324-770 [124371]
    Other proteins in same PDB: d1z25a1
    automatically matched to d1u04a2
    complexed with mn

Details for d1z25a2

PDB Entry: 1z25 (more details), 2.7 Å

PDB Description: structure of p.furiosus argonaute with bound mn2+
PDB Compounds: (A:) Argonaute

SCOPe Domain Sequences for d1z25a2:

Sequence, based on SEQRES records: (download)

>d1z25a2 c.55.3.10 (A:324-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
iaqelenkirvrddkgnsvpisqlnvqksqlllwtnysrkypvilpyevpekfrkireip
mfiildsglladiqnfatnefrelvksmyyslakkynslakkarstneiglpfldfrgke
kvitedlnsdkgiievveqvssfmkgkelglafiaarnklssekfeeikrrlfnlnvisq
vvnedtlknkrdkydrnrldlfvrhnllfqvlsklgvkyyvldyrfnydyiigidvapmk
rsegyiggsavmfdsqgyirkivpikigeqrgesvdmneffkemvdkfkefnikldnkki
lllrdgritnneeeglkyisemfdievvtmdviknhpvrafanmkmyfnlggaiyliphk
lkqakgtpipiklakkriikngkvekqsitrqdvldifiltrlnygsisadmrlpapvhy
ahkfanairnewkikeeflaegflyfv

Sequence, based on observed residues (ATOM records): (download)

>d1z25a2 c.55.3.10 (A:324-770) Argonaute homologue PF0537 {Pyrococcus furiosus [TaxId: 2261]}
iaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiildsg
lladiqnfatnefrelvksmyyekvitedlnsdkgiievveqvssfmkgkelglafiaar
nklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsklgv
kyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvdm
neffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknhp
vrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvldi
filtrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv

SCOPe Domain Coordinates for d1z25a2:

Click to download the PDB-style file with coordinates for d1z25a2.
(The format of our PDB-style files is described here.)

Timeline for d1z25a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z25a1