SCOPe 2.04: Domain d1z24a1: 1z24 A:1-189

Lineage for d1z24a1 (1z24 A:1-189)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Insecticyanin [141462] (1 species)

7. Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [141463] (1 PDB entry)
   Uniprot P00305 1-189

8. Domain d1z24a1: 1z24 A:1-189 [124369]
   complexed with blv

Details for d1z24a1

PDB Entry: 1z24, 2.6 Å

PDB Description: the molecular structure of insecticyanin from the tobacco hornworm manduca sexta l. at 2.6 a resolution.

PDB Compounds: (A:) Insecticyanin A form

SCOPe Domain Sequences for d1z24a1:

Sequence; same for both SEQRES and ATOM records:

>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}
gdifypgycpdvkpvndfdlsafagawheiaklplenenqgkctiaeykydgkkasvyns
fvsngvkeymegdleiapdakytkqgkyvmtfkfgqrvvnlvpwvlatdyknyainyncd
yhpdkkahsihawilskskvlegntkevvdnvlktfshlidaskfisndfseaacqystt
ysltgpdrh

Timeline for d1z24a1:

• d1z24a1 first appeared in SCOP 1.73
  
• d1z24a1 appears in SCOPe 2.03
  
• d1z24a1 appears in SCOPe 2.05
  
• d1z24a1 appears in the current release, SCOPe 2.08