Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Insecticyanin [141462] (1 species) |
Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [141463] (1 PDB entry) Uniprot P00305 1-189 |
Domain d1z24a1: 1z24 A:1-189 [124369] complexed with blv |
PDB Entry: 1z24 (more details), 2.6 Å
SCOPe Domain Sequences for d1z24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} gdifypgycpdvkpvndfdlsafagawheiaklplenenqgkctiaeykydgkkasvyns fvsngvkeymegdleiapdakytkqgkyvmtfkfgqrvvnlvpwvlatdyknyainyncd yhpdkkahsihawilskskvlegntkevvdnvlktfshlidaskfisndfseaacqystt ysltgpdrh
Timeline for d1z24a1: