Lineage for d1z24a1 (1z24 A:1-189)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804402Protein Insecticyanin [141462] (1 species)
  7. 2804403Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [141463] (1 PDB entry)
    Uniprot P00305 1-189
  8. 2804404Domain d1z24a1: 1z24 A:1-189 [124369]
    complexed with blv

Details for d1z24a1

PDB Entry: 1z24 (more details), 2.6 Å

PDB Description: the molecular structure of insecticyanin from the tobacco hornworm manduca sexta l. at 2.6 a resolution.
PDB Compounds: (A:) Insecticyanin A form

SCOPe Domain Sequences for d1z24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}
gdifypgycpdvkpvndfdlsafagawheiaklplenenqgkctiaeykydgkkasvyns
fvsngvkeymegdleiapdakytkqgkyvmtfkfgqrvvnlvpwvlatdyknyainyncd
yhpdkkahsihawilskskvlegntkevvdnvlktfshlidaskfisndfseaacqystt
ysltgpdrh

SCOPe Domain Coordinates for d1z24a1:

Click to download the PDB-style file with coordinates for d1z24a1.
(The format of our PDB-style files is described here.)

Timeline for d1z24a1: