Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab23 [142231] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [142232] (1 PDB entry) Uniprot P35288 8-171 |
Domain d1z22a1: 1z22 A:8-171 [124368] complexed with gdp, mg |
PDB Entry: 1z22 (more details), 2.06 Å
SCOPe Domain Sequences for d1z22a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z22a1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} vaikmvvvgngavgkssmiqryckgiftkdykktigvdflerqiqvndedvrlmlwdtag qeefdaitkayyrgaqacvlvfsttdresfeaisswrekvvaevgdiptalvqnkidlld dscikneeaeglakrlklrfyrtsvkedlnvsevfkylaekhlq
Timeline for d1z22a1: