Lineage for d1z21a1 (1z21 A:42-145)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928494Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 928495Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 928501Family a.243.1.2: YopR Core [140595] (1 protein)
    Pfam PF09025, contains extra N-terminal helix
  6. 928502Protein Yop proteins translocation protein H, YscH (IcrP) [140596] (1 species)
  7. 928503Species Yersinia pestis [TaxId:632] [140597] (1 PDB entry)
    Uniprot P68590 42-145
  8. 928504Domain d1z21a1: 1z21 A:42-145 [124367]

Details for d1z21a1

PDB Entry: 1z21 (more details), 1.5 Å

PDB Description: Crystal structure of the core domain of Yersinia pestis virulence factor YopR
PDB Compounds: (A:) Yop proteins translocation protein H

SCOPe Domain Sequences for d1z21a1:

Sequence, based on SEQRES records: (download)

>d1z21a1 a.243.1.2 (A:42-145) Yop proteins translocation protein H, YscH (IcrP) {Yersinia pestis [TaxId: 632]}
saektrevlwqqyyasnppdhavlevlatpvreallarfgqhqgsvvpaidlpelrsvlq
qfdsfgkrweaillqvlegikpnesqvglpylselinkelmill

Sequence, based on observed residues (ATOM records): (download)

>d1z21a1 a.243.1.2 (A:42-145) Yop proteins translocation protein H, YscH (IcrP) {Yersinia pestis [TaxId: 632]}
saektrevlwqqyyasnppdhavlevlatpvreallarfgqhqgsvvpaidlpelrsvlq
qfdsfgkrweaillqvlegilpylselinkelmill

SCOPe Domain Coordinates for d1z21a1:

Click to download the PDB-style file with coordinates for d1z21a1.
(The format of our PDB-style files is described here.)

Timeline for d1z21a1: