Lineage for d1z1gd2 (1z1g D:177-355)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877365Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 877366Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 877367Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 877438Protein Integrase (Int) [56353] (1 species)
  7. 877439Species Bacteriophage lambda [TaxId:10710] [56354] (4 PDB entries)
  8. 877449Domain d1z1gd2: 1z1g D:177-355 [124360]
    Other proteins in same PDB: d1z1ga1, d1z1gb1, d1z1gc1, d1z1gd1
    automatically matched to d1ae9a_
    mutant

Details for d1z1gd2

PDB Entry: 1z1g (more details), 4.4 Å

PDB Description: crystal structure of a lambda integrase tetramer bound to a holliday junction
PDB Compounds: (D:) integrase

SCOP Domain Sequences for d1z1gd2:

Sequence, based on SEQRES records: (download)

>d1z1gd2 d.163.1.1 (D:177-355) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
glsfegdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkiei

Sequence, based on observed residues (ATOM records): (download)

>d1z1gd2 d.163.1.1 (D:177-355) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
glsfegdpptfhelrslsarlyekqisdkfaqhllghksdtewdkiei

SCOP Domain Coordinates for d1z1gd2:

Click to download the PDB-style file with coordinates for d1z1gd2.
(The format of our PDB-style files is described here.)

Timeline for d1z1gd2: