Lineage for d1z1gc1 (1z1g C:11-59)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536609Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 2536610Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 2536634Family d.10.1.4: lambda integrase N-terminal domain [75344] (1 protein)
  6. 2536635Protein lambda integrase N-terminal domain [75345] (1 species)
  7. 2536636Species Bacteriophage lambda [TaxId:10710] [75346] (3 PDB entries)
  8. 2536642Domain d1z1gc1: 1z1g C:11-59 [124357]
    Other proteins in same PDB: d1z1ga2, d1z1gb2, d1z1gc2, d1z1gd2
    automatically matched to d1kjka_
    protein/DNA complex

Details for d1z1gc1

PDB Entry: 1z1g (more details), 4.4 Å

PDB Description: crystal structure of a lambda integrase tetramer bound to a holliday junction
PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d1z1gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1gc1 d.10.1.4 (C:11-59) lambda integrase N-terminal domain {Bacteriophage lambda [TaxId: 10710]}
dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh

SCOPe Domain Coordinates for d1z1gc1:

Click to download the PDB-style file with coordinates for d1z1gc1.
(The format of our PDB-style files is described here.)

Timeline for d1z1gc1: