Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.10: DNA-binding domain [54170] (1 superfamily) beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.10.1: DNA-binding domain [54171] (4 families) |
Family d.10.1.4: lambda integrase N-terminal domain [75344] (1 protein) |
Protein lambda integrase N-terminal domain [75345] (1 species) |
Species Bacteriophage lambda [TaxId:10710] [75346] (3 PDB entries) |
Domain d1z1ga1: 1z1g A:11-59 [124353] Other proteins in same PDB: d1z1ga2, d1z1gb2, d1z1gc2, d1z1gd2 automatically matched to d1kjka_ protein/DNA complex |
PDB Entry: 1z1g (more details), 4.4 Å
SCOPe Domain Sequences for d1z1ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1ga1 d.10.1.4 (A:11-59) lambda integrase N-terminal domain {Bacteriophage lambda [TaxId: 10710]} dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh
Timeline for d1z1ga1: