SCOPe 2.06: Domain d1z1db2: 1z1d B:3-131

Lineage for d1z1db2 (1z1d B:3-131)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)

6. Protein automated matches [190328] (1 species)
   not a true protein

7. Species Simian virus 40 [TaxId:10633] [187150] (2 PDB entries)

8. Domain d1z1db2: 1z1d B:3-131 [124352]
   Other proteins in same PDB: d1z1da_, d1z1db3
   automated match to d1tbda_

Details for d1z1db2

PDB Entry: 1z1d

PDB Description: structural model for the interaction between rpa32 c-terminal domain and sv40 t antigen origin binding domain.

PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d1z1db2:

Sequence; same for both SEQRES and ATOM records:

>d1z1db2 d.89.1.1 (B:3-131) automated matches {Simian virus 40 [TaxId: 10633]}
kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg
glkehdfnp

Timeline for d1z1db2:

• d1z1db2 first appeared in SCOP 1.73, called d1z1db1
  
• d1z1db2 was called d1z1db1 in SCOPe 2.05
  
• d1z1db2 appears in SCOPe 2.07
  
• d1z1db2 appears in the current release, SCOPe 2.08