![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
![]() | Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) ![]() |
![]() | Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins) |
![]() | Protein automated matches [190328] (1 species) not a true protein |
![]() | Species Simian virus 40 [TaxId:10633] [187150] (2 PDB entries) |
![]() | Domain d1z1db2: 1z1d B:3-131 [124352] Other proteins in same PDB: d1z1da_, d1z1db3 automated match to d1tbda_ |
PDB Entry: 1z1d (more details)
SCOPe Domain Sequences for d1z1db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1db2 d.89.1.1 (B:3-131) automated matches {Simian virus 40 [TaxId: 10633]} kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg glkehdfnp
Timeline for d1z1db2: