Lineage for d1z1db2 (1z1d B:3-131)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528607Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2528608Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2528609Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2528633Protein automated matches [190328] (1 species)
    not a true protein
  7. 2528634Species Simian virus 40 [TaxId:10633] [187150] (2 PDB entries)
  8. 2528636Domain d1z1db2: 1z1d B:3-131 [124352]
    Other proteins in same PDB: d1z1da_, d1z1db3
    automated match to d1tbda_

Details for d1z1db2

PDB Entry: 1z1d (more details)

PDB Description: Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain.
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d1z1db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1db2 d.89.1.1 (B:3-131) automated matches {Simian virus 40 [TaxId: 10633]}
kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg
glkehdfnp

SCOPe Domain Coordinates for d1z1db2:

Click to download the PDB-style file with coordinates for d1z1db2.
(The format of our PDB-style files is described here.)

Timeline for d1z1db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z1db3
View in 3D
Domains from other chains:
(mouse over for more information)
d1z1da_