![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.16: C-terminal domain of RPA32 [46844] (2 proteins) |
![]() | Protein C-terminal domain of RPA32 [46845] (1 species) peptide-recognition motif |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46846] (2 PDB entries) |
![]() | Domain d1z1da1: 1z1d A:202-270 [124351] Other proteins in same PDB: d1z1db1 automatically matched to d1dpua_ |
PDB Entry: 1z1d (more details)
SCOPe Domain Sequences for d1z1da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1da1 a.4.5.16 (A:202-270) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd dhfkstdae
Timeline for d1z1da1: