SCOPe 2.01: Domain d1z1da1: 1z1d A:202-270

Lineage for d1z1da1 (1z1d A:202-270)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.16: C-terminal domain of RPA32 [46844] (1 protein)

6. Protein C-terminal domain of RPA32 [46845] (1 species)
   peptide-recognition motif

7. Species Human (Homo sapiens) [TaxId:9606] [46846] (2 PDB entries)

8. Domain d1z1da1: 1z1d A:202-270 [124351]
   Other proteins in same PDB: d1z1db1
   automatically matched to d1dpua_

Details for d1z1da1

PDB Entry: 1z1d

PDB Description: structural model for the interaction between rpa32 c-terminal domain and sv40 t antigen origin binding domain.

PDB Compounds: (A:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d1z1da1:

Sequence; same for both SEQRES and ATOM records:

>d1z1da1 a.4.5.16 (A:202-270) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]}
angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
dhfkstdae

Timeline for d1z1da1:

• d1z1da1 first appeared in SCOP 1.73
  
• d1z1da1 appears in SCOP 1.75
  
• d1z1da1 appears in SCOPe 2.02
  
• d1z1da1 appears in the current release, SCOPe 2.08, called d1z1da_