Lineage for d1z1da_ (1z1d A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693347Family a.4.5.16: C-terminal domain of RPA32 [46844] (2 proteins)
  6. 2693348Protein C-terminal domain of RPA32 [46845] (1 species)
    peptide-recognition motif
  7. 2693349Species Human (Homo sapiens) [TaxId:9606] [46846] (2 PDB entries)
  8. 2693351Domain d1z1da_: 1z1d A: [124351]
    Other proteins in same PDB: d1z1db2, d1z1db3
    automated match to d1dpua_

Details for d1z1da_

PDB Entry: 1z1d (more details)

PDB Description: structural model for the interaction between rpa32 c-terminal domain and sv40 t antigen origin binding domain.
PDB Compounds: (A:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d1z1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1da_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]}
angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
dhfkstdae

SCOPe Domain Coordinates for d1z1da_:

Click to download the PDB-style file with coordinates for d1z1da_.
(The format of our PDB-style files is described here.)

Timeline for d1z1da_: