Lineage for d1z1ca1 (1z1c A:39-587)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076286Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. 2076303Species Murine minute virus, strain i [TaxId:10794] [49665] (2 PDB entries)
  8. 2076305Domain d1z1ca1: 1z1c A:39-587 [124350]
    automatically matched to d1mvma_
    protein/DNA complex; complexed with ca, d5m

Details for d1z1ca1

PDB Entry: 1z1c (more details), 3.5 Å

PDB Description: structural determinants of tissue tropism and in vivo pathogenicity for the parvovirus minute virus of mice
PDB Compounds: (A:) coat protein vp2

SCOPe Domain Sequences for d1z1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1ca1 b.121.5.2 (A:39-587) Parvovirus (panleukopenia virus) capsid protein {Murine minute virus, strain i [TaxId: 10794]}
gvgvstgsydnqthyrflgdgwveitalatrlvhlnmpksenycrirvhnttdtsvkgnm
akddaheqiwtpwslvdanawgvwlqpsdwqyicntmsqlnlvsldqeifnvvlktvteq
dsggqaikiynndltacmmvavdsnnilpytpaansmetlgfypwkptiaspyryyfcvd
rdlsvtyenqegtiehnvmgtpkgmnsqfftientqqitllrtgdefatgtyyfdtnpvk
lthtwqtnrqlgqppllstfpeadtdagtltaqgsrhgatqmevnwvseairtrpaqvgf
cqphndfeasragpfaapkvpadvtqgmdreangsvrysygkqhgenwaahgpaperytw
detnfgsgrdtrdgfiqsaplvvppplngiltnanpigtkndihfsnvfnsygplttfsh
pspvypqgqiwdkeldlehkprlhitapfvcknnapgqmlvrlgpnltdqydpngatlsr
ivtygtffwkgkltmraklranttwnpvyqvsvedngnsymsvtkwlptatgnmqsvpli
trpvarnty

SCOPe Domain Coordinates for d1z1ca1:

Click to download the PDB-style file with coordinates for d1z1ca1.
(The format of our PDB-style files is described here.)

Timeline for d1z1ca1: