Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (4 families) |
Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins) automatically mapped to Pfam PF00740 |
Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species) |
Species Murine minute virus, strain i [TaxId:10794] [49665] (2 PDB entries) |
Domain d1z1ca1: 1z1c A:39-587 [124350] automatically matched to d1mvma_ protein/DNA complex; complexed with ca, d5m |
PDB Entry: 1z1c (more details), 3.5 Å
SCOPe Domain Sequences for d1z1ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1ca1 b.121.5.2 (A:39-587) Parvovirus (panleukopenia virus) capsid protein {Murine minute virus, strain i [TaxId: 10794]} gvgvstgsydnqthyrflgdgwveitalatrlvhlnmpksenycrirvhnttdtsvkgnm akddaheqiwtpwslvdanawgvwlqpsdwqyicntmsqlnlvsldqeifnvvlktvteq dsggqaikiynndltacmmvavdsnnilpytpaansmetlgfypwkptiaspyryyfcvd rdlsvtyenqegtiehnvmgtpkgmnsqfftientqqitllrtgdefatgtyyfdtnpvk lthtwqtnrqlgqppllstfpeadtdagtltaqgsrhgatqmevnwvseairtrpaqvgf cqphndfeasragpfaapkvpadvtqgmdreangsvrysygkqhgenwaahgpaperytw detnfgsgrdtrdgfiqsaplvvppplngiltnanpigtkndihfsnvfnsygplttfsh pspvypqgqiwdkeldlehkprlhitapfvcknnapgqmlvrlgpnltdqydpngatlsr ivtygtffwkgkltmraklranttwnpvyqvsvedngnsymsvtkwlptatgnmqsvpli trpvarnty
Timeline for d1z1ca1: