Lineage for d1z1ba1 (1z1b A:11-59)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891193Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1891194Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 1891218Family d.10.1.4: lambda integrase N-terminal domain [75344] (1 protein)
  6. 1891219Protein lambda integrase N-terminal domain [75345] (1 species)
  7. 1891220Species Bacteriophage lambda [TaxId:10710] [75346] (3 PDB entries)
  8. 1891221Domain d1z1ba1: 1z1b A:11-59 [124346]
    Other proteins in same PDB: d1z1ba2, d1z1bb2
    automatically matched to d1kjka_
    protein/DNA complex

Details for d1z1ba1

PDB Entry: 1z1b (more details), 3.8 Å

PDB Description: crystal structure of a lambda integrase dimer bound to a coc' core site
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1z1ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1ba1 d.10.1.4 (A:11-59) lambda integrase N-terminal domain {Bacteriophage lambda [TaxId: 10710]}
dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh

SCOPe Domain Coordinates for d1z1ba1:

Click to download the PDB-style file with coordinates for d1z1ba1.
(The format of our PDB-style files is described here.)

Timeline for d1z1ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z1ba2