SCOP 1.73: Domain d1z1ab1: 1z1a B:486-611

Lineage for d1z1ab1 (1z1a B:486-611)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.339: ORC1-binding domain [144004] (1 superfamily)
   complex fold, composed of an alpha hairpin, meander beta-sheet and a five-stranded barrel of unusual topology

4. Superfamily d.339.1: ORC1-binding domain [144005] (1 family)

5. Family d.339.1.1: ORC1-binding domain [144006] (1 protein)

6. Protein Regulatory protein SIR1 [144007] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144008] (3 PDB entries)

8. Domain d1z1ab1: 1z1a B:486-611 [124345]
   automatically matched to 1Z1A A:484-611
   mutant

Details for d1z1ab1

PDB Entry: 1z1a, 2.5 Å

PDB Description: s. cerevisiae sir1 orc-interaction domain

PDB Compounds: (B:) Regulatory protein SIR1

SCOP Domain Sequences for d1z1ab1:

Sequence, based on SEQRES records:

>d1z1ab1 d.339.1.1 (B:486-611) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqd
piplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlascvpillddqtv
qylydd

Sequence, based on observed residues (ATOM records):

>d1z1ab1 d.339.1.1 (B:486-611) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqd
piplkaktlfkfckqikkkflrgadfklhtlpteanmtvlascvpillddqtvqylydd

Timeline for d1z1ab1:

• d1z1ab1 is new in SCOP 1.73
  
• d1z1ab1 appears in SCOP 1.75
  
• d1z1ab1 appears in the current release, SCOPe 2.08, called d1z1ab_