Lineage for d1z1ab_ (1z1a B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011245Fold d.339: ORC1-binding domain [144004] (1 superfamily)
    complex fold, composed of an alpha hairpin, meander beta-sheet and a five-stranded barrel of unusual topology
  4. 3011246Superfamily d.339.1: ORC1-binding domain [144005] (1 family) (S)
    automatically mapped to Pfam PF11603
  5. 3011247Family d.339.1.1: ORC1-binding domain [144006] (1 protein)
  6. 3011248Protein Regulatory protein SIR1 [144007] (1 species)
  7. 3011249Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144008] (3 PDB entries)
    Uniprot P21691 484-611! Uniprot P21691 485-613! Uniprot P21691 487-611
  8. 3011251Domain d1z1ab_: 1z1a B: [124345]
    automated match to d1z1aa1

Details for d1z1ab_

PDB Entry: 1z1a (more details), 2.5 Å

PDB Description: s. cerevisiae sir1 orc-interaction domain
PDB Compounds: (B:) Regulatory protein SIR1

SCOPe Domain Sequences for d1z1ab_:

Sequence, based on SEQRES records: (download)

>d1z1ab_ d.339.1.1 (B:) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqd
piplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlascvpillddqtv
qylydd

Sequence, based on observed residues (ATOM records): (download)

>d1z1ab_ d.339.1.1 (B:) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyqd
piplkaktlfkfckqikkkflrgadfklhtlpteanmtvlascvpillddqtvqylydd

SCOPe Domain Coordinates for d1z1ab_:

Click to download the PDB-style file with coordinates for d1z1ab_.
(The format of our PDB-style files is described here.)

Timeline for d1z1ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z1aa1