Lineage for d1z1aa1 (1z1a A:484-611)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882723Fold d.339: ORC1-binding domain [144004] (1 superfamily)
    complex fold, composed of an alpha hairpin, meander beta-sheet and a five-stranded barrel of unusual topology
  4. 882724Superfamily d.339.1: ORC1-binding domain [144005] (1 family) (S)
  5. 882725Family d.339.1.1: ORC1-binding domain [144006] (1 protein)
  6. 882726Protein Regulatory protein SIR1 [144007] (1 species)
  7. 882727Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144008] (3 PDB entries)
    Uniprot P21691 484-611! Uniprot P21691 485-613! Uniprot P21691 487-611
  8. 882729Domain d1z1aa1: 1z1a A:484-611 [124344]
    mutant

Details for d1z1aa1

PDB Entry: 1z1a (more details), 2.5 Å

PDB Description: s. cerevisiae sir1 orc-interaction domain
PDB Compounds: (A:) Regulatory protein SIR1

SCOP Domain Sequences for d1z1aa1:

Sequence, based on SEQRES records: (download)

>d1z1aa1 d.339.1.1 (A:484-611) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
steeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkky
qdpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlascvpillddq
tvqylydd

Sequence, based on observed residues (ATOM records): (download)

>d1z1aa1 d.339.1.1 (A:484-611) Regulatory protein SIR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
steeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkky
qdpiplkaktlfkfckqikkkflrgadfklhtlpmtvlascvpillddqtvqylydd

SCOP Domain Coordinates for d1z1aa1:

Click to download the PDB-style file with coordinates for d1z1aa1.
(The format of our PDB-style files is described here.)

Timeline for d1z1aa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z1ab1