Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) |
Protein Tyrosine phosphatase [52790] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries) |
Domain d1z12a_: 1z12 A: [124342] automated match to d1bvh__ complexed with vo4 |
PDB Entry: 1z12 (more details), 2.2 Å
SCOPe Domain Sequences for d1z12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z12a_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]} aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd pqkqliiedpyygndadfetvyqqcvrccraflekvr
Timeline for d1z12a_: