SCOPe 2.02: Domain d1z12a_: 1z12 A:

Lineage for d1z12a_ (1z12 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)

8. Domain d1z12a_: 1z12 A: [124342]
   automated match to d1bvh__
   complexed with vo4

Details for d1z12a_

PDB Entry: 1z12, 2.2 Å

PDB Description: Crystal Structure of Bovine Low Molecular Weight PTPase Complexed with Vanadate

PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d1z12a_:

Sequence; same for both SEQRES and ATOM records:

>d1z12a_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

Timeline for d1z12a_:

• d1z12a_ first appeared in SCOP 1.73, called d1z12a1
  
• d1z12a_ appears in SCOPe 2.01
  
• d1z12a_ appears in SCOPe 2.03
  
• d1z12a_ appears in the current release, SCOPe 2.08