Lineage for d1z12a1 (1z12 A:1-157)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833067Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 833068Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family) (S)
    share the common active site structure with the family II
  5. 833069Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)
  6. 833093Protein Tyrosine phosphatase [52790] (4 species)
  7. 833101Species Cow (Bos taurus) [TaxId:9913] [52791] (7 PDB entries)
  8. 833106Domain d1z12a1: 1z12 A:1-157 [124342]
    automatically matched to d1bvh__
    complexed with vo4

Details for d1z12a1

PDB Entry: 1z12 (more details), 2.2 Å

PDB Description: Crystal Structure of Bovine Low Molecular Weight PTPase Complexed with Vanadate
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOP Domain Sequences for d1z12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z12a1 c.44.1.1 (A:1-157) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr

SCOP Domain Coordinates for d1z12a1:

Click to download the PDB-style file with coordinates for d1z12a1.
(The format of our PDB-style files is described here.)

Timeline for d1z12a1: