Lineage for d1z0za_ (1z0z A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020486Fold e.52: NAD kinase/diacylglycerol kinase-like [111330] (1 superfamily)
    2 domains: d1 [alpha/beta; related to the PFK N-terminal domain (53784)]; d2 [all-beta; atypical beta-sandwich made of 4 structural repeats of beta(3) unit]
  4. 3020487Superfamily e.52.1: NAD kinase/diacylglycerol kinase-like [111331] (3 families) (S)
  5. 3020488Family e.52.1.1: NAD kinase-like [111332] (1 protein)
    Pfam PF01513
  6. 3020489Protein Inorganic polyphosphate/ATP-NAD kinase PpnK [111333] (2 species)
  7. 3020490Species Archaeoglobus fulgidus [TaxId:2234] [111334] (4 PDB entries)
    Uniprot O30297; d1:1-96; d2:101-227
  8. 3020497Domain d1z0za_: 1z0z A: [124338]
    complexed with nad

Details for d1z0za_

PDB Entry: 1z0z (more details), 2.85 Å

PDB Description: Crystal structure of a NAD kinase from Archaeoglobus fulgidus in complex with NAD
PDB Compounds: (A:) Probable inorganic polyphosphate/ATP-NAD kinase

SCOPe Domain Sequences for d1z0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0za_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]}
mraavvyktdghvkrieealkrlevevelfnqpseelenfdfivsvggdgtilrilqklk
rcppifgintgrvgllthaspenfevelkkavekfeverfprvscsampdvlalneiavl
srkpakmidvalrvdgvevdrircdgfivatqigstgyafsaggpvvepylecfilipia
pfrfgwkpyvvsmerkieviaekaivvadgqksvdfdgeitieksefpavffknekrfrn
lfgkvrsig

SCOPe Domain Coordinates for d1z0za_:

Click to download the PDB-style file with coordinates for d1z0za_.
(The format of our PDB-style files is described here.)

Timeline for d1z0za_: