Lineage for d1z0rb1 (1z0r B:1-53)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1335949Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 1335950Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 1335978Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins)
    dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
    automatically mapped to Pfam PF04014
  6. 1335983Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)
  7. 1335984Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries)
  8. 1335990Domain d1z0rb1: 1z0r B:1-53 [124327]
    automatically matched to d1ekta_

Details for d1z0rb1

PDB Entry: 1z0r (more details)

PDB Description: Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transcription-State Regulator AbrB
PDB Compounds: (B:) Transition state regulatory protein abrB

SCOPe Domain Sequences for d1z0rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0rb1 b.129.1.3 (B:1-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt

SCOPe Domain Coordinates for d1z0rb1:

Click to download the PDB-style file with coordinates for d1z0rb1.
(The format of our PDB-style files is described here.)

Timeline for d1z0rb1:

Domains from other chains:
(mouse over for more information)
d1z0ra1