SCOPe 2.07: Domain d1z0ra_: 1z0r A:

Lineage for d1z0ra_ (1z0r A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.3: AbrB N-terminal domain-like [54743] (3 proteins)
   dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
   automatically mapped to Pfam PF04014

6. Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [54745] (5 PDB entries)

8. Domain d1z0ra_: 1z0r A: [124326]
   automated match to d1z0ra1

Details for d1z0ra_

PDB Entry: 1z0r

PDB Description: solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb

PDB Compounds: (A:) Transition state regulatory protein abrB

SCOPe Domain Sequences for d1z0ra_:

Sequence; same for both SEQRES and ATOM records:

>d1z0ra_ b.129.1.3 (A:) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt

Timeline for d1z0ra_:

• d1z0ra_ first appeared in SCOP 1.73, called d1z0ra1
  
• d1z0ra_ appears in SCOPe 2.06
  
• d1z0ra_ appears in the current release, SCOPe 2.08