Lineage for d1z0ra1 (1z0r A:1-53)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813439Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 813440Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 813468Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins)
    dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
  6. 813473Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)
  7. 813474Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries)
  8. 813479Domain d1z0ra1: 1z0r A:1-53 [124326]
    automatically matched to d1ekta_

Details for d1z0ra1

PDB Entry: 1z0r (more details)

PDB Description: Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transcription-State Regulator AbrB
PDB Compounds: (A:) Transition state regulatory protein abrB

SCOP Domain Sequences for d1z0ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0ra1 b.129.1.3 (A:1-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt

SCOP Domain Coordinates for d1z0ra1:

Click to download the PDB-style file with coordinates for d1z0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1z0ra1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z0rb1