| Root: SCOPe 2.08 |
| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.18: SPy1572-like [140121] (1 family) ![]() forms homodimer: an open bundle, different from the TRAM dimer automatically mapped to Pfam PF08930 |
| Family a.2.18.1: SPy1572-like [140122] (1 protein) |
| Protein Hypothetical protein SPy1572 [140123] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [140124] (1 PDB entry) Uniprot Q99YR7 1-77 |
| Domain d1z0pa1: 1z0p A:1-77 [124325] |
PDB Entry: 1z0p (more details), 1.7 Å
SCOPe Domain Sequences for d1z0pa1:
Sequence, based on SEQRES records: (download)
>d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}
msyekeflkdfedwvktqiqvnqlamatsqevaqedgderakdafiryeskldayefllg
kfdnykngkafhdipde
>d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}
msyekeflkdfedwvktqiqvnqlamatsqevaderakdafiryeskldayefllgkfdn
ykngkafhdipde
Timeline for d1z0pa1: