Lineage for d1z0pa1 (1z0p A:1-77)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980326Superfamily a.2.18: SPy1572-like [140121] (1 family) (S)
    forms homodimer: an open bundle, different from the TRAM dimer
    automatically mapped to Pfam PF08930
  5. 1980327Family a.2.18.1: SPy1572-like [140122] (1 protein)
  6. 1980328Protein Hypothetical protein SPy1572 [140123] (1 species)
  7. 1980329Species Streptococcus pyogenes [TaxId:1314] [140124] (1 PDB entry)
    Uniprot Q99YR7 1-77
  8. 1980330Domain d1z0pa1: 1z0p A:1-77 [124325]

Details for d1z0pa1

PDB Entry: 1z0p (more details), 1.7 Å

PDB Description: Crystal structure of the Protein of Unknown Function SPY1572 from Streptococcus pyogenes
PDB Compounds: (A:) hypothetical protein SPy1572

SCOPe Domain Sequences for d1z0pa1:

Sequence, based on SEQRES records: (download)

>d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}
msyekeflkdfedwvktqiqvnqlamatsqevaqedgderakdafiryeskldayefllg
kfdnykngkafhdipde

Sequence, based on observed residues (ATOM records): (download)

>d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}
msyekeflkdfedwvktqiqvnqlamatsqevaderakdafiryeskldayefllgkfdn
ykngkafhdipde

SCOPe Domain Coordinates for d1z0pa1:

Click to download the PDB-style file with coordinates for d1z0pa1.
(The format of our PDB-style files is described here.)

Timeline for d1z0pa1: