SCOPe 2.08: Domain d1z0pa1: 1z0p A:1-77

Lineage for d1z0pa1 (1z0p A:1-77)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.18: SPy1572-like [140121] (1 family)
   forms homodimer: an open bundle, different from the TRAM dimer
   automatically mapped to Pfam PF08930

5. Family a.2.18.1: SPy1572-like [140122] (1 protein)

6. Protein Hypothetical protein SPy1572 [140123] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [140124] (1 PDB entry)
   Uniprot Q99YR7 1-77

8. Domain d1z0pa1: 1z0p A:1-77 [124325]

Details for d1z0pa1

PDB Entry: 1z0p, 1.7 Å

PDB Description: Crystal structure of the Protein of Unknown Function SPY1572 from Streptococcus pyogenes

PDB Compounds: (A:) hypothetical protein SPy1572

SCOPe Domain Sequences for d1z0pa1:

Sequence, based on SEQRES records:

>d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}
msyekeflkdfedwvktqiqvnqlamatsqevaqedgderakdafiryeskldayefllg
kfdnykngkafhdipde

Sequence, based on observed residues (ATOM records):

>d1z0pa1 a.2.18.1 (A:1-77) Hypothetical protein SPy1572 {Streptococcus pyogenes [TaxId: 1314]}
msyekeflkdfedwvktqiqvnqlamatsqevaderakdafiryeskldayefllgkfdn
ykngkafhdipde

Timeline for d1z0pa1:

• d1z0pa1 first appeared in SCOP 1.73
  
• d1z0pa1 appears in SCOPe 2.07