Lineage for d1z0kd1 (1z0k D:441-501)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633806Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) (S)
  5. 633807Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (1 protein)
  6. 633808Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species)
  7. 633809Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)
  8. 633813Domain d1z0kd1: 1z0k D:441-501 [124324]
    Other proteins in same PDB: d1z0ka1, d1z0kc1
    automatically matched to 1Z0K B:441-501
    complexed with gtp, mes, mg

Details for d1z0kd1

PDB Entry: 1z0k (more details), 1.92 Å

PDB Description: structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5
PDB Compounds: (D:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOP Domain Sequences for d1z0kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0kd1 a.2.19.1 (D:441-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq
t

SCOP Domain Coordinates for d1z0kd1:

Click to download the PDB-style file with coordinates for d1z0kd1.
(The format of our PDB-style files is described here.)

Timeline for d1z0kd1: