Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) |
Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 proteins) |
Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries) Uniprot Q9H1K0 441-501! Uniprot Q9H1K0 456-501! Uniprot Q9H1K0 734-784 |
Domain d1z0kb1: 1z0k B:441-501 [124322] Other proteins in same PDB: d1z0ka1, d1z0kc_, d1z0kd_ 1st Rab-binding domain complexed with gtp, mes, mg |
PDB Entry: 1z0k (more details), 1.92 Å
SCOPe Domain Sequences for d1z0kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0kb1 a.2.19.1 (B:441-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]} egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq t
Timeline for d1z0kb1: