SCOPe 2.07: Domain d1z0kb1: 1z0k B:441-501

Lineage for d1z0kb1 (1z0k B:441-501)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family)

5. Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 proteins)

6. Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)
   Uniprot Q9H1K0 441-501! Uniprot Q9H1K0 456-501! Uniprot Q9H1K0 734-784

8. Domain d1z0kb1: 1z0k B:441-501 [124322]
   Other proteins in same PDB: d1z0ka1, d1z0kc_, d1z0kd_
   1st Rab-binding domain
   complexed with gtp, mes, mg

Details for d1z0kb1

PDB Entry: 1z0k, 1.92 Å

PDB Description: structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5

PDB Compounds: (B:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOPe Domain Sequences for d1z0kb1:

Sequence; same for both SEQRES and ATOM records:

>d1z0kb1 a.2.19.1 (B:441-501) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq
t

Timeline for d1z0kb1:

• d1z0kb1 first appeared in SCOP 1.73
  
• d1z0kb1 appears in SCOPe 2.06
  
• d1z0kb1 appears in the current release, SCOPe 2.08