Lineage for d1z0jb1 (1z0j B:734-784)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476789Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) (S)
  5. 1476790Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 proteins)
  6. 1476791Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species)
  7. 1476792Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)
    Uniprot Q9H1K0 441-501! Uniprot Q9H1K0 456-501! Uniprot Q9H1K0 734-784
  8. 1476793Domain d1z0jb1: 1z0j B:734-784 [124320]
    Other proteins in same PDB: d1z0ja1
    2nd Rab-binding domain
    complexed with gol, gtp, mg, trs

Details for d1z0jb1

PDB Entry: 1z0j (more details), 1.32 Å

PDB Description: structure of gtp-bound rab22q64l gtpase in complex with the minimal rab binding domain of rabenosyn-5
PDB Compounds: (B:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOPe Domain Sequences for d1z0jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0jb1 a.2.19.1 (B:734-784) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
ieeelllqqidnikayifdakqcgrldevevltenlrelkhtlakqkggtd

SCOPe Domain Coordinates for d1z0jb1:

Click to download the PDB-style file with coordinates for d1z0jb1.
(The format of our PDB-style files is described here.)

Timeline for d1z0jb1: