SCOP 1.73: Domain d1z0jb1: 1z0j B:734-784

Lineage for d1z0jb1 (1z0j B:734-784)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family)

5. Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (1 protein)

6. Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)

8. Domain d1z0jb1: 1z0j B:734-784 [124320]
   Other proteins in same PDB: d1z0ja1
   2nd Rab-binding domain
   complexed with gol, gtp, mg, trs; mutant

Details for d1z0jb1

PDB Entry: 1z0j, 1.32 Å

PDB Description: structure of gtp-bound rab22q64l gtpase in complex with the minimal rab binding domain of rabenosyn-5

PDB Compounds: (B:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOP Domain Sequences for d1z0jb1:

Sequence; same for both SEQRES and ATOM records:

>d1z0jb1 a.2.19.1 (B:734-784) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
ieeelllqqidnikayifdakqcgrldevevltenlrelkhtlakqkggtd

Timeline for d1z0jb1:

• d1z0jb1 is new in SCOP 1.73
  
• d1z0jb1 appears in SCOP 1.75
  
• d1z0jb1 appears in the current release, SCOPe 2.08