Lineage for d1z0jb1 (1z0j B:734-784)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633806Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) (S)
  5. 633807Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (1 protein)
  6. 633808Protein FYVE finger-containing Rab5 effector protein rabenosyn-5 [140127] (1 species)
  7. 633809Species Human (Homo sapiens) [TaxId:9606] [140128] (3 PDB entries)
  8. 633810Domain d1z0jb1: 1z0j B:734-784 [124320]
    Other proteins in same PDB: d1z0ja1
    2nd Rab-binding domain
    complexed with gol, gtp, mg, trs; mutant

Details for d1z0jb1

PDB Entry: 1z0j (more details), 1.32 Å

PDB Description: Structure of GTP-Bound Rab22Q64L GTPase in complex with the minimal Rab binding domain of Rabenosyn-5
PDB Compounds: (B:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOP Domain Sequences for d1z0jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0jb1 a.2.19.1 (B:734-784) FYVE finger-containing Rab5 effector protein rabenosyn-5 {Human (Homo sapiens) [TaxId: 9606]}
ieeelllqqidnikayifdakqcgrldevevltenlrelkhtlakqkggtd

SCOP Domain Coordinates for d1z0jb1:

Click to download the PDB-style file with coordinates for d1z0jb1.
(The format of our PDB-style files is described here.)

Timeline for d1z0jb1: