SCOP 1.73: Domain d1z0ja1: 1z0j A:2-168

Lineage for d1z0ja1 (1z0j A:2-168)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-22a [142253] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142254] (2 PDB entries)

8. Domain d1z0ja1: 1z0j A:2-168 [124319]
   Other proteins in same PDB: d1z0jb1
   complexed with gol, gtp, mg, trs; mutant

Details for d1z0ja1

PDB Entry: 1z0j, 1.32 Å

PDB Description: structure of gtp-bound rab22q64l gtpase in complex with the minimal rab binding domain of rabenosyn-5

PDB Compounds: (A:) Ras-related protein Rab-22A

SCOP Domain Sequences for d1z0ja1:

Sequence; same for both SEQRES and ATOM records:

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}
alrelkvcllgdtgvgkssimwrfvedsfdpninptigasfmtktvqyqnelhkfliwdt
aglerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkcd
ltdvrevmerdakdyadsihaifvetsaknaininelfieisrrips

Timeline for d1z0ja1:

• d1z0ja1 is new in SCOP 1.73
  
• d1z0ja1 appears in SCOP 1.75
  
• d1z0ja1 appears in the current release, SCOPe 2.08