Lineage for d1z0ja1 (1z0j A:2-168)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867357Protein Rab-22a [142253] (1 species)
  7. 2867358Species Mouse (Mus musculus) [TaxId:10090] [142254] (2 PDB entries)
    Uniprot P35285 2-167! Uniprot P35285 2-168
  8. 2867359Domain d1z0ja1: 1z0j A:2-168 [124319]
    Other proteins in same PDB: d1z0ja2, d1z0jb1
    complexed with gol, gtp, mg, trs

Details for d1z0ja1

PDB Entry: 1z0j (more details), 1.32 Å

PDB Description: structure of gtp-bound rab22q64l gtpase in complex with the minimal rab binding domain of rabenosyn-5
PDB Compounds: (A:) Ras-related protein Rab-22A

SCOPe Domain Sequences for d1z0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}
alrelkvcllgdtgvgkssimwrfvedsfdpninptigasfmtktvqyqnelhkfliwdt
aglerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkcd
ltdvrevmerdakdyadsihaifvetsaknaininelfieisrrips

SCOPe Domain Coordinates for d1z0ja1:

Click to download the PDB-style file with coordinates for d1z0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1z0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z0ja2
View in 3D
Domains from other chains:
(mouse over for more information)
d1z0jb1