![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab-22a [142253] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [142254] (2 PDB entries) Uniprot P35285 2-167! Uniprot P35285 2-168 |
![]() | Domain d1z0ja1: 1z0j A:2-168 [124319] Other proteins in same PDB: d1z0ja2, d1z0jb1 complexed with gol, gtp, mg, trs |
PDB Entry: 1z0j (more details), 1.32 Å
SCOPe Domain Sequences for d1z0ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} alrelkvcllgdtgvgkssimwrfvedsfdpninptigasfmtktvqyqnelhkfliwdt aglerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkcd ltdvrevmerdakdyadsihaifvetsaknaininelfieisrrips
Timeline for d1z0ja1: