Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab5c [52603] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [52604] (3 PDB entries) |
Domain d1z0dc_: 1z0d C: [124312] automated match to d1huqa_ complexed with gdp, mg, po4 |
PDB Entry: 1z0d (more details), 2.2 Å
SCOPe Domain Sequences for d1z0dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0dc_ c.37.1.8 (C:) Rab5c {Mouse (Mus musculus) [TaxId: 10090]} icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl askravefqeaqayaddnsllfmetsaktamnvneifmaiakklp
Timeline for d1z0dc_: