SCOPe 2.02: Domain d1z0da1: 1z0d A:19-183

Lineage for d1z0da1 (1z0d A:19-183)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab5c [52603] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [52604] (3 PDB entries)

8. Domain d1z0da1: 1z0d A:19-183 [124311]
   complexed with gdp, mg, po4

Details for d1z0da1

PDB Entry: 1z0d, 2.2 Å

PDB Description: gdp-bound rab5c gtpase

PDB Compounds: (A:) Ras-related protein Rab-5C

SCOPe Domain Sequences for d1z0da1:

Sequence; same for both SEQRES and ATOM records:

>d1z0da1 c.37.1.8 (A:19-183) Rab5c {Mouse (Mus musculus) [TaxId: 10090]}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
askravefqeaqayaddnsllfmetsaktamnvneifmaiakklp

Timeline for d1z0da1:

• d1z0da1 first appeared in SCOP 1.73
  
• d1z0da1 appears in SCOPe 2.01
  
• d1z0da1 appears in SCOPe 2.03
  
• d1z0da1 appears in the current release, SCOPe 2.08