Lineage for d1z0da1 (1z0d A:19-183)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867473Protein Rab5c [52603] (1 species)
  7. 2867474Species Mouse (Mus musculus) [TaxId:10090] [52604] (3 PDB entries)
  8. 2867477Domain d1z0da1: 1z0d A:19-183 [124311]
    complexed with gdp, mg, po4

Details for d1z0da1

PDB Entry: 1z0d (more details), 2.2 Å

PDB Description: gdp-bound rab5c gtpase
PDB Compounds: (A:) Ras-related protein Rab-5C

SCOPe Domain Sequences for d1z0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0da1 c.37.1.8 (A:19-183) Rab5c {Mouse (Mus musculus) [TaxId: 10090]}
icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
askravefqeaqayaddnsllfmetsaktamnvneifmaiakklp

SCOPe Domain Coordinates for d1z0da1:

Click to download the PDB-style file with coordinates for d1z0da1.
(The format of our PDB-style files is described here.)

Timeline for d1z0da1: