Lineage for d1z0ad_ (1z0a D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128604Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2128699Domain d1z0ad_: 1z0a D: [124310]
    Other proteins in same PDB: d1z0aa1
    automated match to d1oiva_
    complexed with gdp, mg

Details for d1z0ad_

PDB Entry: 1z0a (more details), 2.12 Å

PDB Description: GDP-Bound Rab2A GTPase
PDB Compounds: (D:) Ras-related protein Rab-2A

SCOPe Domain Sequences for d1z0ad_:

Sequence, based on SEQRES records: (download)

>d1z0ad_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwdt
agqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksd
lesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek

Sequence, based on observed residues (ATOM records): (download)

>d1z0ad_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaylfkyiiigdtgvgksclllqftdltigvefgarmitidgkqiklqiwdtagqesfrs
itrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignksdlesrrevk
keegeafarelifmetsaktasnveeafintakeiyek

SCOPe Domain Coordinates for d1z0ad_:

Click to download the PDB-style file with coordinates for d1z0ad_.
(The format of our PDB-style files is described here.)

Timeline for d1z0ad_: