Lineage for d1z0ac_ (1z0a C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598123Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)
  8. 1598210Domain d1z0ac_: 1z0a C: [124309]
    Other proteins in same PDB: d1z0aa1
    automated match to d1oiva_
    complexed with gdp, mg

Details for d1z0ac_

PDB Entry: 1z0a (more details), 2.12 Å

PDB Description: GDP-Bound Rab2A GTPase
PDB Compounds: (C:) Ras-related protein Rab-2A

SCOPe Domain Sequences for d1z0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0ac_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwd
tagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignks
dlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek

SCOPe Domain Coordinates for d1z0ac_:

Click to download the PDB-style file with coordinates for d1z0ac_.
(The format of our PDB-style files is described here.)

Timeline for d1z0ac_: