Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab2a [142265] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142266] (1 PDB entry) |
Domain d1z0ac1: 1z0a C:2-170 [124309] automatically matched to 1Z0A A:2-170 complexed with gdp, mg |
PDB Entry: 1z0a (more details), 2.12 Å
SCOP Domain Sequences for d1z0ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0ac1 c.37.1.8 (C:2-170) Rab2a {Human (Homo sapiens) [TaxId: 9606]} ayaylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmitidgkqiklqiwd tagqesfrsitrsyyrgaagallvyditrrdtfnhlttwledarqhsnsnmvimlignks dlesrrevkkeegeafarehglifmetsaktasnveeafintakeiyek
Timeline for d1z0ac1: