Lineage for d1z08d1 (1z08 D:18-183)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696095Protein Rab21 [142285] (1 species)
  7. 696096Species Human (Homo sapiens) [TaxId:9606] [142286] (4 PDB entries)
  8. 696100Domain d1z08d1: 1z08 D:18-183 [124306]
    automatically matched to 1Z08 A:17-183
    complexed with gnp, mg; mutant

Details for d1z08d1

PDB Entry: 1z08 (more details), 1.8 Å

PDB Description: gppnhp-bound rab21 q53g mutant gtpase
PDB Compounds: (D:) Ras-related protein Rab-21

SCOP Domain Sequences for d1z08d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z08d1 c.37.1.8 (D:18-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
ysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdtag
qerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidle
kerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

SCOP Domain Coordinates for d1z08d1:

Click to download the PDB-style file with coordinates for d1z08d1.
(The format of our PDB-style files is described here.)

Timeline for d1z08d1: