SCOP 1.73: Domain d1z08d1: 1z08 D:18-183

Lineage for d1z08d1 (1z08 D:18-183)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab21 [142285] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142286] (4 PDB entries)

8. Domain d1z08d1: 1z08 D:18-183 [124306]
   automatically matched to 1Z08 A:17-183
   complexed with gnp, mg; mutant

Details for d1z08d1

PDB Entry: 1z08, 1.8 Å

PDB Description: gppnhp-bound rab21 q53g mutant gtpase

PDB Compounds: (D:) Ras-related protein Rab-21

SCOP Domain Sequences for d1z08d1:

Sequence; same for both SEQRES and ATOM records:

>d1z08d1 c.37.1.8 (D:18-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
ysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdtag
qerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidle
kerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

Timeline for d1z08d1:

• d1z08d1 is new in SCOP 1.73
  
• d1z08d1 appears in SCOP 1.75
  
• d1z08d1 appears in the current release, SCOPe 2.08, called d1z08d_