Lineage for d1z08d_ (1z08 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872077Domain d1z08d_: 1z08 D: [124306]
    Other proteins in same PDB: d1z08a1
    automated match to d1tu4a_
    complexed with gnp, mg; mutant

Details for d1z08d_

PDB Entry: 1z08 (more details), 1.8 Å

PDB Description: gppnhp-bound rab21 q53g mutant gtpase
PDB Compounds: (D:) Ras-related protein Rab-21

SCOPe Domain Sequences for d1z08d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z08d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdtag
qerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidle
kerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

SCOPe Domain Coordinates for d1z08d_:

Click to download the PDB-style file with coordinates for d1z08d_.
(The format of our PDB-style files is described here.)

Timeline for d1z08d_: