Lineage for d1z08b_ (1z08 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1849903Domain d1z08b_: 1z08 B: [124304]
    Other proteins in same PDB: d1z08a1
    automated match to d1tu4a_
    complexed with gnp, mg; mutant

Details for d1z08b_

PDB Entry: 1z08 (more details), 1.8 Å

PDB Description: gppnhp-bound rab21 q53g mutant gtpase
PDB Compounds: (B:) Ras-related protein Rab-21

SCOPe Domain Sequences for d1z08b_:

Sequence, based on SEQRES records: (download)

>d1z08b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

Sequence, based on observed residues (ATOM records): (download)

>d1z08b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
gqyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq
eaesyaesvgakhyhtsakqnkgieelfldlckrmiet

SCOPe Domain Coordinates for d1z08b_:

Click to download the PDB-style file with coordinates for d1z08b_.
(The format of our PDB-style files is described here.)

Timeline for d1z08b_: