SCOP 1.75: Domain d1z08b1: 1z08 B:17-183

Lineage for d1z08b1 (1z08 B:17-183)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab21 [142285] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142286] (5 PDB entries)
   Uniprot Q9UL25 16-182

8. Domain d1z08b1: 1z08 B:17-183 [124304]
   automatically matched to 1Z08 A:17-183
   complexed with gnp, mg; mutant

Details for d1z08b1

PDB Entry: 1z08, 1.8 Å

PDB Description: gppnhp-bound rab21 q53g mutant gtpase

PDB Compounds: (B:) Ras-related protein Rab-21

SCOP Domain Sequences for d1z08b1:

Sequence, based on SEQRES records:

>d1z08b1 c.37.1.8 (B:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl
ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet

Sequence, based on observed residues (ATOM records):

>d1z08b1 c.37.1.8 (B:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}
aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta
gqyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvsiq
eaesyaesvgakhyhtsakqnkgieelfldlckrmiet

Timeline for d1z08b1:

• d1z08b1 first appeared in SCOP 1.73
  
• d1z08b1 is called d1z08b_ in SCOPe 2.01
  
• d1z08b1 appears in the current release, SCOPe 2.08, called d1z08b_