![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab21 [142285] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142286] (3 PDB entries) Uniprot Q9UL25 16-182 |
![]() | Domain d1z08a1: 1z08 A:17-183 [124303] Other proteins in same PDB: d1z08b_, d1z08c_, d1z08d_ complexed with gnp, mg; mutant |
PDB Entry: 1z08 (more details), 1.8 Å
SCOPe Domain Sequences for d1z08a1:
Sequence, based on SEQRES records: (download)
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta gqerfhalgpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidl ekerhvsiqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} aysfkvvllgegcvgktslvlrycenkfndkhittlgasfltkklniggkrvnlaiwdta gqpiyyrdsngailvyditdedsfqkvknwvkelrkmlgneiclcivgnkidlekerhvs iqeaesyaesvgakhyhtsakqnkgieelfldlckrmiet
Timeline for d1z08a1: