Lineage for d1z07a1 (1z07 A:19-182)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867473Protein Rab5c [52603] (1 species)
  7. 2867474Species Mouse (Mus musculus) [TaxId:10090] [52604] (3 PDB entries)
  8. 2867475Domain d1z07a1: 1z07 A:19-182 [124302]
    Other proteins in same PDB: d1z07a2
    complexed with gnp, mg; mutant

Details for d1z07a1

PDB Entry: 1z07 (more details), 1.81 Å

PDB Description: gppnhp-bound rab5c g55q mutant gtpase
PDB Compounds: (A:) Ras-related protein Rab-5C

SCOPe Domain Sequences for d1z07a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z07a1 c.37.1.8 (A:19-182) Rab5c {Mouse (Mus musculus) [TaxId: 10090]}
icqfklvllgesavgksslvlrfvkgqfheyqestiqaafltqtvclddttvkfeiwdta
gqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl

SCOPe Domain Coordinates for d1z07a1:

Click to download the PDB-style file with coordinates for d1z07a1.
(The format of our PDB-style files is described here.)

Timeline for d1z07a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z07a2