Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab-33b [142279] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [142280] (2 PDB entries) Uniprot O35963 32-196 |
Domain d1z06a1: 1z06 A:32-196 [124301] complexed with gnp, mg |
PDB Entry: 1z06 (more details), 1.81 Å
SCOPe Domain Sequences for d1z06a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} rifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdtag qerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnkcd lrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtla
Timeline for d1z06a1: